ALPHATIDE · Growth hormone

Sermorelin

✳ Thoughtfully sourced✳ Clearly presented

Synthetic peptide, a fragment of growth hormone-releasing hormone (GHRH) consisting of 29 amino acids. Sermorelin stimulates the pituitary gland to produce and release growth hormone. It promotes increased levels of IGF-1, which can positively affect metabolism, body composition, sleep quality, and other functions related to growth hormone activity. This product is intended for use as a cosmetic skincare product. Consult a healthcare professional before use.

Stimulates natural growth-hormone production
Improves sleep quality
Raises physical endurance
Supports tissue renewal

pituitary GHRH receptor

Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2
Molecular weight: 3358 Da

Variants

10 mg / vials vial 90.00 USD In stock: 18 Delivery: 2–7 days
20 mg / vials vial 120.00 USD In stock: 18 Delivery: 2–7 days

Storage

2 years under proper storage conditions.

For research use only.

Visualise with this product ↗